Lineage for d5xi5e_ (5xi5 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012522Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2012523Family a.137.10.1: Stathmin [101495] (2 protein domains)
  6. 2012524Protein Stathmin 4 [101496] (1 species)
  7. 2012525Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (66 PDB entries)
  8. 2297063Domain d5xi5e_: 5xi5 E: [340364]
    Other proteins in same PDB: d5xi5a1, d5xi5a2, d5xi5b1, d5xi5b2, d5xi5c1, d5xi5c2, d5xi5d1, d5xi5d2, d5xi5f1, d5xi5f2
    automated match to d4i55e_
    complexed with acp, ca, gdp, gtp, mes, mg, pn6

Details for d5xi5e_

PDB Entry: 5xi5 (more details), 2.81 Å

PDB Description: crystal structure of t2r-ttl-po5 complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5xi5e_:

Sequence, based on SEQRES records: (download)

>d5xi5e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5xi5e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke

SCOPe Domain Coordinates for d5xi5e_:

Click to download the PDB-style file with coordinates for d5xi5e_.
(The format of our PDB-style files is described here.)

Timeline for d5xi5e_:

  • d5xi5e_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29