Lineage for d5u6gj_ (5u6g J:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063324Protein automated matches [190295] (6 species)
    not a true protein
  7. 2063340Species Human (Homo sapiens) [TaxId:9606] [187133] (57 PDB entries)
  8. 2297062Domain d5u6gj_: 5u6g J: [340363]
    automated match to d4zcbb_
    complexed with ret; mutant

Details for d5u6gj_

PDB Entry: 5u6g (more details), 2.6 Å

PDB Description: crystal structure of the holo domain-swapped dimer mutant q108k:k40d human cellular retinol binding protein ii bound with all trans retinal
PDB Compounds: (J:) Retinol-binding protein 2

SCOPe Domain Sequences for d5u6gj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u6gj_ b.60.1.2 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfatrkiavrltqtdvidqdgdnfktkttstfrny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

SCOPe Domain Coordinates for d5u6gj_:

Click to download the PDB-style file with coordinates for d5u6gj_.
(The format of our PDB-style files is described here.)

Timeline for d5u6gj_:

  • d5u6gj_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29