Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.0: automated matches [191390] (1 protein) not a true family |
Protein automated matches [190500] (8 species) not a true protein |
Species Meiothermus taiwanensis [TaxId:1339250] [340350] (1 PDB entry) |
Domain d5wsla_: 5wsl A: [340352] automated match to d4dzta_ complexed with ca, so4 |
PDB Entry: 5wsl (more details), 1.5 Å
SCOPe Domain Sequences for d5wsla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wsla_ c.41.1.0 (A:) automated matches {Meiothermus taiwanensis [TaxId: 1339250]} atqtgatwgldridqrtlplsgtftysntgsgvnayiidtgirvshsefggratavfdai gdgqngndcnghgthvagtvggtvygvaksvrlyavrvlncsgsgsnsgviagvdwvrqn arrpavanmslgggassaldtavnnainagitfalaagnsnrdacqfsparvtagitvga ttstdarasysnygscldlfapgssitsawissdtstntisgtsmatphvagvaalylqs npsaspatvrnaivgnatsgvvsnagrrspnlllysnyenly
Timeline for d5wsla_: