Lineage for d5wsla_ (5wsl A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129453Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2129454Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2129825Family c.41.1.0: automated matches [191390] (1 protein)
    not a true family
  6. 2129826Protein automated matches [190500] (8 species)
    not a true protein
  7. 2129836Species Meiothermus taiwanensis [TaxId:1339250] [340350] (1 PDB entry)
  8. 2129837Domain d5wsla_: 5wsl A: [340352]
    automated match to d4dzta_
    complexed with ca, so4

Details for d5wsla_

PDB Entry: 5wsl (more details), 1.5 Å

PDB Description: structural studies of keratinase from meiothermus taiwanensis wr-220
PDB Compounds: (A:) keratinase

SCOPe Domain Sequences for d5wsla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wsla_ c.41.1.0 (A:) automated matches {Meiothermus taiwanensis [TaxId: 1339250]}
atqtgatwgldridqrtlplsgtftysntgsgvnayiidtgirvshsefggratavfdai
gdgqngndcnghgthvagtvggtvygvaksvrlyavrvlncsgsgsnsgviagvdwvrqn
arrpavanmslgggassaldtavnnainagitfalaagnsnrdacqfsparvtagitvga
ttstdarasysnygscldlfapgssitsawissdtstntisgtsmatphvagvaalylqs
npsaspatvrnaivgnatsgvvsnagrrspnlllysnyenly

SCOPe Domain Coordinates for d5wsla_:

Click to download the PDB-style file with coordinates for d5wsla_.
(The format of our PDB-style files is described here.)

Timeline for d5wsla_: