Lineage for d5xfha_ (5xfh A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068877Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2068917Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2069033Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2069034Protein automated matches [190516] (4 species)
    not a true protein
  7. 2297044Species Oryza sativa [TaxId:39947] [340345] (1 PDB entry)
  8. 2297045Domain d5xfha_: 5xfh A: [340346]
    automated match to d1x1vb_
    complexed with bma, gal, man, nag

Details for d5xfha_

PDB Entry: 5xfh (more details), 1.9 Å

PDB Description: crystal structure of orysata lectin in complex with biantennary n- glycan
PDB Compounds: (A:) Salt stress-induced protein

SCOPe Domain Sequences for d5xfha_:

Sequence, based on SEQRES records: (download)

>d5xfha_ b.77.3.0 (A:) automated matches {Oryza sativa [TaxId: 39947]}
tlvkigpwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggge
ststeiklgsseqikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplqd
sghvvgffgrsgtlidaigiyvhp

Sequence, based on observed residues (ATOM records): (download)

>d5xfha_ b.77.3.0 (A:) automated matches {Oryza sativa [TaxId: 39947]}
tlvkigpwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggst
steiklsseqikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplqdsgh
vvgffgrsgtlidaigiyvhp

SCOPe Domain Coordinates for d5xfha_:

Click to download the PDB-style file with coordinates for d5xfha_.
(The format of our PDB-style files is described here.)

Timeline for d5xfha_:

  • d5xfha_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29