Lineage for d5w1ob1 (5w1o B:21-474)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823225Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2823226Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2823296Protein automated matches [191200] (13 species)
    not a true protein
  7. 2823369Species Human papillomavirus [TaxId:10566] [189523] (1 PDB entry)
  8. 2823371Domain d5w1ob1: 5w1o B:21-474 [340341]
    Other proteins in same PDB: d5w1oa2, d5w1ob2, d5w1oc2, d5w1od2, d5w1oe2
    automated match to d1dzla_

Details for d5w1ob1

PDB Entry: 5w1o (more details), 2.8 Å

PDB Description: crystal structure of hpv16 l1 pentamer bound to heparin oligosaccharides
PDB Compounds: (B:) Major capsid protein L1

SCOPe Domain Sequences for d5w1ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w1ob1 b.121.6.1 (B:21-474) automated matches {Human papillomavirus [TaxId: 10566]}
vvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpdp
nkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaanag
vdnrecismdykqtqlcligckppigehwgkgspctnvavnpgdcpplelintviqdgdm
vdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrhl
fnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqghn
ngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlck
itltadvmtyihsmnstiledwngggsgaedplkkytfwevnlkekfsadldqfplgrkf
llqagl

SCOPe Domain Coordinates for d5w1ob1:

Click to download the PDB-style file with coordinates for d5w1ob1.
(The format of our PDB-style files is described here.)

Timeline for d5w1ob1: