Lineage for d5wiha_ (5wih A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2206129Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2206130Protein automated matches [190418] (18 species)
    not a true protein
  7. 2206143Species Escherichia coli [TaxId:562] [226145] (7 PDB entries)
  8. 2297039Domain d5wiha_: 5wih A: [340340]
    automated match to d4u4la_
    complexed with zn

Details for d5wiha_

PDB Entry: 5wih (more details), 1.35 Å

PDB Description: structure of new delhi metallo-beta-lactamase 12 (ndm-12)
PDB Compounds: (A:) Metallo-beta-lactamase NDM-12

SCOPe Domain Sequences for d5wiha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wiha_ d.157.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhsl
tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
ddadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5wiha_:

Click to download the PDB-style file with coordinates for d5wiha_.
(The format of our PDB-style files is described here.)

Timeline for d5wiha_:

  • d5wiha_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29