Lineage for d5tmaa2 (5tma A:188-362)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2471274Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2471275Protein automated matches [190312] (14 species)
    not a true protein
  7. 2471389Species Zymomonas mobilis [TaxId:542] [255669] (6 PDB entries)
  8. 2471398Domain d5tmaa2: 5tma A:188-362 [340327]
    Other proteins in same PDB: d5tmaa1, d5tmaa3, d5tmab1, d5tmab3
    automated match to d1zpda1
    complexed with edo, mg, so4, tpp; mutant

Details for d5tmaa2

PDB Entry: 5tma (more details), 1.67 Å

PDB Description: zymomonas mobilis pyruvate decarboxylase mutant pdc-2.3
PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d5tmaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmaa2 c.31.1.0 (A:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfienrdkvavlvgsklraaaaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaekvskktgaldffkslnagelkkadpadps

SCOPe Domain Coordinates for d5tmaa2:

Click to download the PDB-style file with coordinates for d5tmaa2.
(The format of our PDB-style files is described here.)

Timeline for d5tmaa2: