SCOPe 2.06: Domain d5vefa_: 5vef A:

Lineage for d5vefa_ (5vef A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries)

8. Domain d5vefa_: 5vef A: [340324]
   automated match to d2q0na_
   complexed with act, m77

Details for d5vefa_

PDB Entry: 5vef, 1.75 Å

PDB Description: pak4 kinase domain in complex with fasudil

PDB Compounds: (A:) serine/threonine-protein kinase pak 4

SCOPe Domain Sequences for d5vefa_:

Sequence; same for both SEQRES and ATOM records:

>d5vefa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqqr
rellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqiaa
vclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvgtp
ywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknlh
kvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnr

Timeline for d5vefa_:

• d5vefa_ is new in SCOPe 2.06-stable
  
• d5vefa_ appears in SCOPe 2.07
  
• d5vefa_ appears in the current release, SCOPe 2.08