SCOPe 2.06: Domain d5w1oc1: 5w1o C:21-474

Lineage for d5w1oc1 (5w1o C:21-474)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families)

5. Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)

6. Protein automated matches [191200] (7 species)
   not a true protein

7. Species Human papillomavirus [TaxId:10566] [189523] (2 PDB entries)

8. Domain d5w1oc1: 5w1o C:21-474 [340320]
   Other proteins in same PDB: d5w1oa2, d5w1ob2, d5w1oc2, d5w1od2, d5w1oe2
   automated match to d1dzla_
   complexed with ids, jhm

Details for d5w1oc1

PDB Entry: 5w1o, 2.8 Å

PDB Description: crystal structure of hpv16 l1 pentamer bound to heparin oligosaccharides

PDB Compounds: (C:) Major capsid protein L1

SCOPe Domain Sequences for d5w1oc1:

Sequence; same for both SEQRES and ATOM records:

>d5w1oc1 b.121.6.1 (C:21-474) automated matches {Human papillomavirus [TaxId: 10566]}
vvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpdp
nkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaanag
vdnrecismdykqtqlcligckppigehwgkgspctnvavnpgdcpplelintviqdgdm
vdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrhl
fnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqghn
ngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlck
itltadvmtyihsmnstiledwngggsgaedplkkytfwevnlkekfsadldqfplgrkf
llqagl

Timeline for d5w1oc1:

• d5w1oc1 is new in SCOPe 2.06-stable
  
• d5w1oc1 appears in SCOPe 2.07
  
• d5w1oc1 appears in the current release, SCOPe 2.08