Lineage for d5tmab3 (5tma B:363-565)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108851Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2108852Protein automated matches [227126] (20 species)
    not a true protein
  7. 2109146Species Zymomonas mobilis [TaxId:542] [255668] (6 PDB entries)
  8. 2297016Domain d5tmab3: 5tma B:363-565 [340317]
    Other proteins in same PDB: d5tmaa2, d5tmab2
    automated match to d1zpda3
    complexed with edo, mg, so4, tpp; mutant

Details for d5tmab3

PDB Entry: 5tma (more details), 1.67 Å

PDB Description: zymomonas mobilis pyruvate decarboxylase mutant pdc-2.3
PDB Compounds: (B:) pyruvate decarboxylase

SCOPe Domain Sequences for d5tmab3:

Sequence, based on SEQRES records: (download)

>d5tmab3 c.36.1.0 (B:363-565) automated matches {Zymomonas mobilis [TaxId: 542]}
aplvnaeiarqiedlltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpaa
fgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpyn
niknwdyaalmevfngnggydsgagkglkaktaaeleeaikvaldntdgptliecfiare
dcteelvkwgervaaansrkpvn

Sequence, based on observed residues (ATOM records): (download)

>d5tmab3 c.36.1.0 (B:363-565) automated matches {Zymomonas mobilis [TaxId: 542]}
aplvnaeiarqiedlltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpaa
fgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpyn
niknwdyaalmevfngnsgagkglkaktaaeleeaikvaldntdgptliecfiaredcte
elvkwgervaaansrkpvn

SCOPe Domain Coordinates for d5tmab3:

Click to download the PDB-style file with coordinates for d5tmab3.
(The format of our PDB-style files is described here.)

Timeline for d5tmab3:

  • d5tmab3 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29