Lineage for d5wa8b_ (5wa8 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499927Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2499928Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2499929Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 protein domains)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2500028Protein automated matches [191082] (3 species)
    not a true protein
  7. 2500034Species Human (Homo sapiens) [TaxId:9606] [189791] (22 PDB entries)
  8. 2500048Domain d5wa8b_: 5wa8 B: [340313]
    automated match to d3tw2a_
    complexed with 9za, cl; mutant

Details for d5wa8b_

PDB Entry: 5wa8 (more details), 1.3 Å

PDB Description: human histidine triad nucleotide binding protein 1 (hhint1) h112n mutant nucleoside l-ala phosphoramidate substrate complex
PDB Compounds: (B:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d5wa8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wa8b_ d.13.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesll
ghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvnlhvlggrqmhwppg

SCOPe Domain Coordinates for d5wa8b_:

Click to download the PDB-style file with coordinates for d5wa8b_.
(The format of our PDB-style files is described here.)

Timeline for d5wa8b_: