Lineage for d5tijb1 (5tij B:2-140)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947634Protein Enolase [54828] (10 species)
  7. 2947678Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries)
    Uniprot P09104
  8. 2947714Domain d5tijb1: 5tij B:2-140 [340310]
    Other proteins in same PDB: d5tija2, d5tijb2
    automated match to d2akza2
    complexed with 5tx, mg

Details for d5tijb1

PDB Entry: 5tij (more details), 2.63 Å

PDB Description: structure of human enolase 2 with ((3s,5s)-1,5-dihydroxy-3-methyl-2- oxopyrrolidin-3-yl)phosphonate (purified enantiomer)
PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d5tijb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tijb1 d.54.1.1 (B:2-140) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d5tijb1:

Click to download the PDB-style file with coordinates for d5tijb1.
(The format of our PDB-style files is described here.)

Timeline for d5tijb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tijb2