SCOPe 2.06: Domain d5vg3a_: 5vg3 A:

Lineage for d5vg3a_ (5vg3 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)

6. Protein automated matches [190784] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188035] (6 PDB entries)

8. Domain d5vg3a_: 5vg3 A: [340301]
   automated match to d2uyba_
   complexed with act, gol, mn, mpd

Details for d5vg3a_

PDB Entry: 5vg3, 1.45 Å

PDB Description: structure of oxalate decarboxylase from bacillus subtilis at ph 4.6

PDB Compounds: (A:) Oxalate decarboxylase

SCOPe Domain Sequences for d5vg3a_:

Sequence; same for both SEQRES and ATOM records:

>d5vg3a_ b.82.1.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mkkqndipqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdthnrle
kggyarevtvrelpisenlasvnmrlkpgairelhwhkeaewaymiygsarvtivdekgr
sfiddvgegdlwyfpsglphsiqaleegaefllvfddgsfsenstfqltdwlahtpkevi
aanfgvtkeeisnlpgkekyifenqlpgslkddivegpngevpypftyrlleqepieseg
gkvyiadstnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdgha
rtfnyqagdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqah
ldlgkdftdvlskekhpvvkkk

Timeline for d5vg3a_:

• d5vg3a_ is new in SCOPe 2.06-stable
  
• d5vg3a_ appears in SCOPe 2.07
  
• d5vg3a_ appears in the current release, SCOPe 2.08