Lineage for d2qdfa1 (2qdf A:21-91)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568089Fold d.391: POlypeptide TRansport Associated (PORTRA) domain-like [310567] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; mixed beta sheet, order 132
  4. 2568090Superfamily d.391.1: POlypeptide TRansport Associated (PORTRA) domain-like [310598] (2 families) (S)
    Pfam PF07244
  5. 2568091Family d.391.1.1: POlypeptide TRansport Associated (PORTRA) domain [310646] (3 proteins)
  6. 2568095Protein YaeT [310792] (1 species)
  7. 2568096Species Escherichia coli K-12 [TaxId:83333] [311050] (2 PDB entries)
  8. 2568097Domain d2qdfa1: 2qdf A:21-91 [340297]
    Other proteins in same PDB: d2qdfa5
    automated match to d2qcza1
    complexed with mg

Details for d2qdfa1

PDB Entry: 2qdf (more details), 2.2 Å

PDB Description: structure of n-terminal domain of e. coli yaet
PDB Compounds: (A:) Outer membrane protein assembly factor yaeT

SCOPe Domain Sequences for d2qdfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qdfa1 d.391.1.1 (A:21-91) YaeT {Escherichia coli K-12 [TaxId: 83333]}
aegfvvkdihfeglqrvavgaallsmpvrtgdtvndedisntiralfatgnfedvrvlrd
gdtllvqvker

SCOPe Domain Coordinates for d2qdfa1:

Click to download the PDB-style file with coordinates for d2qdfa1.
(The format of our PDB-style files is described here.)

Timeline for d2qdfa1: