Lineage for d5tiqb1 (5tiq B:13-221)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075469Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 2075525Family b.121.2.3: Major capsid protein vp54 [82013] (2 protein domains)
  6. 2296991Protein automated matches [340292] (1 species)
    not a true protein
  7. 2296992Species Paramecium bursaria chlorella virus 1 [TaxId:10506] [340293] (1 PDB entry)
  8. 2296993Domain d5tiqb1: 5tiq B:13-221 [340294]
    Other proteins in same PDB: d5tiqb2
    automated match to d1m3ya1
    complexed with 7cv, bgc, fuc, gla, hg, man, rm4, xxr, xyp

Details for d5tiqb1

PDB Entry: 5tiq (more details), 2.54 Å

PDB Description: the structure of the major capsid protein of pbcv-1
PDB Compounds: (B:) Major capsid protein

SCOPe Domain Sequences for d5tiqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tiqb1 b.121.2.3 (B:13-221) automated matches {Paramecium bursaria chlorella virus 1 [TaxId: 10506]}
aqdvyltgnpqitffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivv
efvltkggnggttyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrm
tdwvnnelvgaqkrfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngss
aiagaaqptmsvwvdyifldtqertrfaq

SCOPe Domain Coordinates for d5tiqb1:

Click to download the PDB-style file with coordinates for d5tiqb1.
(The format of our PDB-style files is described here.)

Timeline for d5tiqb1:

  • d5tiqb1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29