SCOPe 2.08: Domain d5odzd_: 5odz D:

Lineage for d5odzd_ (5odz D:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Enterobacter cloacae [TaxId:550] [271105] (8 PDB entries)

8. Domain d5odzd_: 5odz D: [340291]
   automated match to d4s2kb_
   complexed with cl, mg, pge

Details for d5odzd_

PDB Entry: 5odz, 2.07 Å

PDB Description: crystal structure of the beta-lactamase oxa-163

PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d5odzd_:

Sequence; same for both SEQRES and ATOM records:

>d5odzd_ e.3.1.0 (D:) automated matches {Enterobacter cloacae [TaxId: 550]}
kewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsliald
lgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhaf
dygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangd
yiiraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip

Timeline for d5odzd_:

• d5odzd_ first appeared in SCOPe 2.06
  
• d5odzd_ appears in SCOPe 2.07