Lineage for d5odzd_ (5odz D:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (40 species)
    not a true protein
  7. 2218912Species Enterobacter cloacae [TaxId:550] [271105] (6 PDB entries)
  8. 2296990Domain d5odzd_: 5odz D: [340291]
    automated match to d4s2kb_
    complexed with cl, mg, pge

Details for d5odzd_

PDB Entry: 5odz (more details), 2.07 Å

PDB Description: crystal structure of the beta-lactamase oxa-163
PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d5odzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5odzd_ e.3.1.0 (D:) automated matches {Enterobacter cloacae [TaxId: 550]}
kewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsliald
lgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhaf
dygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangd
yiiraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip

SCOPe Domain Coordinates for d5odzd_:

Click to download the PDB-style file with coordinates for d5odzd_.
(The format of our PDB-style files is described here.)

Timeline for d5odzd_:

  • d5odzd_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29