Lineage for d5ov7a1 (5ov7 A:1-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (7 species)
    not a true protein
  7. 2107855Species Cow (Bos taurus) [TaxId:9913] [226564] (43 PDB entries)
  8. 2296982Domain d5ov7a1: 5ov7 A:1-245 [340283]
    Other proteins in same PDB: d5ov7a2, d5ov7b2, d5ov7c2, d5ov7d2, d5ov7e_, d5ov7f1, d5ov7f2, d5ov7f3
    automated match to d4ihja1
    complexed with 6fs, acp, ca, gdp, gol, gtp, mes, mg

Details for d5ov7a1

PDB Entry: 5ov7 (more details), 2.4 Å

PDB Description: tubulin - rigosertib complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5ov7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ov7a1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5ov7a1:

Click to download the PDB-style file with coordinates for d5ov7a1.
(The format of our PDB-style files is described here.)

Timeline for d5ov7a1:

  • d5ov7a1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29