Lineage for d5opca_ (5opc A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404792Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)
  6. 2404793Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)
  7. 2404794Species Human (Homo sapiens) [TaxId:9606] [82196] (34 PDB entries)
  8. 2404818Domain d5opca_: 5opc A: [340276]
    automated match to d3p3na_
    protein/DNA complex; complexed with a1z, gol, so4, zn

Details for d5opca_

PDB Entry: 5opc (more details), 2.3 Å

PDB Description: factor inhibiting hif (fih) in complex with zinc and vadadustat
PDB Compounds: (A:) Hypoxia-inducible factor 1-alpha inhibitor

SCOPe Domain Sequences for d5opca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5opca_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
sgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlv
ypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefve
klqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlllig
megnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdye
rfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieypl
kahqkvaimrniekmlgealgnpqevgpllntmikgryn

SCOPe Domain Coordinates for d5opca_:

Click to download the PDB-style file with coordinates for d5opca_.
(The format of our PDB-style files is described here.)

Timeline for d5opca_: