Lineage for d5ocqa_ (5ocq A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373777Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2373845Protein kappa-Carrageenase, catalytic [49930] (2 species)
    1,3-alpha-1,4-beta-D-galactose-4-sulfate-3,6-anhydro-D-galactose 4 galactohydrolase
  7. 2373846Species Pseudoalteromonas carrageenovora [TaxId:227] [49931] (2 PDB entries)
  8. 2373848Domain d5ocqa_: 5ocq A: [340269]
    Other proteins in same PDB: d5ocqb2
    automated match to d1dypa_
    complexed with 9rn, cit, g4s

Details for d5ocqa_

PDB Entry: 5ocq (more details), 1.7 Å

PDB Description: crystal structure of the complex of the kappa-carrageenase from pseudoalteromonas carrageenovora with an oligotetrasaccharide of kappa-carrageenan
PDB Compounds: (A:) kappa-carrageenase

SCOPe Domain Sequences for d5ocqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ocqa_ b.29.1.2 (A:) kappa-Carrageenase, catalytic {Pseudoalteromonas carrageenovora [TaxId: 227]}
smqppiakpgetwilqakrsdefnvkdatkwnfqtenygvwswknenatvsngklklttk
reshqrtfwdgcnqqqvanyplyytsgvaksratgnygyyearikgastfpgvspafwmy
stidrsltkegdvqyseidvvdltqksavresdhdlhnivvkngkptwmrpgsfpqtnhn
gyhlpfdprndfhtygvnvtkdkitwyvdgeivgekdnlywhrqmnltlsqglraphtqw
kcnqfypsanksaegfptsmevdyvrtwvkv

SCOPe Domain Coordinates for d5ocqa_:

Click to download the PDB-style file with coordinates for d5ocqa_.
(The format of our PDB-style files is described here.)

Timeline for d5ocqa_: