Lineage for d5ocra_ (5ocr A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373777Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 protein domains)
    Pfam PF00722
    beta-Glucanase-like
  6. 2373845Protein kappa-Carrageenase, catalytic [49930] (2 species)
    1,3-alpha-1,4-beta-D-galactose-4-sulfate-3,6-anhydro-D-galactose 4 galactohydrolase
  7. 2373850Species Zobellia galactanivorans [TaxId:63186] [340263] (1 PDB entry)
  8. 2373851Domain d5ocra_: 5ocr A: [340268]
    automated match to d1dypa_
    complexed with gol, mg

Details for d5ocra_

PDB Entry: 5ocr (more details), 1.66 Å

PDB Description: crystal structure of the kappa-carrageenase zobellia_236 from zobellia galactanivorans
PDB Compounds: (A:) kappa-carrageenase

SCOPe Domain Sequences for d5ocra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ocra_ b.29.1.2 (A:) kappa-Carrageenase, catalytic {Zobellia galactanivorans [TaxId: 63186]}
qqptktsnpndqwtikwsasdefnkndpdwakwiktgnlpntsawkwnnqknvkisngia
eltmrhnanntpdggtyftsgifksyqkftygyfeakiqgadigegvcpsfwlysdfdys
vangetvyseidvvelqqfdwyeghqddiydmdlnlhavvkengqgvwkrpkmypqeqln
kwrapwdpskdfhiygcevnqneiiwyvdgvevarkpnkywhrpmnvtlslglrkpfvkf
fdnknnainpetdakareklsdiptsmyvdyvrvweks

SCOPe Domain Coordinates for d5ocra_:

Click to download the PDB-style file with coordinates for d5ocra_.
(The format of our PDB-style files is described here.)

Timeline for d5ocra_: