Lineage for d5ghla_ (5ghl A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378394Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2378395Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2378497Protein Glucoamylase, granular starch-binding domain [49460] (1 species)
  7. 2378498Species Aspergillus niger [TaxId:5061] [49461] (5 PDB entries)
  8. 2378499Domain d5ghla_: 5ghl A: [340244]
    automated match to d1kula_
    complexed with gol, so4

Details for d5ghla_

PDB Entry: 5ghl (more details), 2 Å

PDB Description: crystal structure analysis of the starch-binding domain of glucoamylase from aspergillus niger
PDB Compounds: (A:) glucoamylase

SCOPe Domain Sequences for d5ghla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ghla_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr

SCOPe Domain Coordinates for d5ghla_:

Click to download the PDB-style file with coordinates for d5ghla_.
(The format of our PDB-style files is described here.)

Timeline for d5ghla_: