Lineage for d5ghlc_ (5ghl C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041485Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2041486Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2041588Protein Glucoamylase, granular starch-binding domain [49460] (1 species)
  7. 2041589Species Aspergillus niger [TaxId:5061] [49461] (5 PDB entries)
  8. 2041592Domain d5ghlc_: 5ghl C: [340242]
    automated match to d1kula_
    complexed with gol, so4

Details for d5ghlc_

PDB Entry: 5ghl (more details), 2 Å

PDB Description: crystal structure analysis of the starch-binding domain of glucoamylase from aspergillus niger
PDB Compounds: (C:) glucoamylase

SCOPe Domain Sequences for d5ghlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ghlc_ b.3.1.1 (C:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr

SCOPe Domain Coordinates for d5ghlc_:

Click to download the PDB-style file with coordinates for d5ghlc_.
(The format of our PDB-style files is described here.)

Timeline for d5ghlc_: