Lineage for d5u1aa_ (5u1a A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990537Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1990538Protein automated matches [190036] (38 species)
    not a true protein
  7. 2296796Species Helicobacter pylori [TaxId:210] [340097] (2 PDB entries)
  8. 2296940Domain d5u1aa_: 5u1a A: [340241]
    automated match to d2jd60_
    complexed with cl, fe, gol, na

Details for d5u1aa_

PDB Entry: 5u1a (more details), 2 Å

PDB Description: ferritin with gc mtre loop 1 inserted at his34
PDB Compounds: (A:) Ferritin,MtrE protein chimera

SCOPe Domain Sequences for d5u1aa_:

Sequence, based on SEQRES records: (download)

>d5u1aa_ a.25.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcytgsrqgslsggnvsssysldgcgtflfd
haaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhisesinniv
dhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksr
k

Sequence, based on observed residues (ATOM records): (download)

>d5u1aa_ a.25.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcytgssysldgcgtflfdhaaeeyehakkl
ivflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatf
nflqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOPe Domain Coordinates for d5u1aa_:

Click to download the PDB-style file with coordinates for d5u1aa_.
(The format of our PDB-style files is described here.)

Timeline for d5u1aa_:

  • d5u1aa_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29