Lineage for d6aoqb_ (6aoq B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266930Species Influenza a virus (a/brisbane/10/2007(h3n2)) [TaxId:476294] [340208] (7 PDB entries)
  8. 2266937Domain d6aoqb_: 6aoq B: [340232]
    Other proteins in same PDB: d6aoqa1, d6aoqa2
    automated match to d1qfub_
    complexed with bma, man, nag

Details for d6aoqb_

PDB Entry: 6aoq (more details), 2.35 Å

PDB Description: crystal structure of the a/brisbane/10/2007 (h3n2) influenza virus hemagglutinin apo form
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6aoqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aoqb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza a virus (a/brisbane/10/2007(h3n2)) [TaxId: 476294]}
gifgaiagfiengwegmvdgwygfrhqnsegigqaadlkstqaaidqingklnrligktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d6aoqb_:

Click to download the PDB-style file with coordinates for d6aoqb_.
(The format of our PDB-style files is described here.)

Timeline for d6aoqb_: