SCOPe 2.06: Domain d6aova1: 6aov A:11-325

Lineage for d6aova1 (6aov A:11-325)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (25 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [187142] (23 PDB entries)

8. Domain d6aova1: 6aov A:11-325 [340222]
   Other proteins in same PDB: d6aova2, d6aovb_
   automated match to d2yp5a1
   complexed with bma, gal, man, nag, sia

Details for d6aova1

PDB Entry: 6aov, 1.75 Å

PDB Description: crystal structure of the a/brisbane/10/2007 (h3n2) influenza virus hemagglutinin in complex with 6'-slnln

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6aova1:

Sequence; same for both SEQRES and ATOM records:

>d6aova1 b.19.1.2 (A:11-325) automated matches {Influenza A virus [TaxId: 11320]}
atlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv
tqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgtdnd
qiflyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
qntlklatgmrnvpe

Timeline for d6aova1:

• d6aova1 is new in SCOPe 2.06-stable
  
• d6aova1 appears in SCOPe 2.07
  
• d6aova1 appears in the current release, SCOPe 2.08