SCOPe 2.06: Domain d6axua_: 6axu A:

Lineage for d6axua_ (6axu A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (37 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [279808] (16 PDB entries)

8. Domain d6axua_: 6axu A: [340219]
   automated match to d3lg5a_
   complexed with btm, mg, pop

Details for d6axua_

PDB Entry: 6axu, 1.82 Å

PDB Description: w203y epi-isozizaene synthase

PDB Compounds: (A:) Epi-isozizaene synthase

SCOPe Domain Sequences for d6axua_:

Sequence; same for both SEQRES and ATOM records:

>d6axua_ a.128.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
avppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmag
yylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhe
dtlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrr
ltfahwiytdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiagdevh
nlgislithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgav
ranvgnmrnwfssvywfhhesgrymvdswddrstppyvnn

Timeline for d6axua_:

• d6axua_ is new in SCOPe 2.06-stable
  
• d6axua_ appears in SCOPe 2.07
  
• d6axua_ appears in the current release, SCOPe 2.08