Lineage for d6aqjb2 (6aqj B:183-327)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003567Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2003568Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2003777Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2003778Protein automated matches [226851] (35 species)
    not a true protein
  7. 2296896Species Staphylococcus aureus [TaxId:273036] [340197] (1 PDB entry)
  8. 2296906Domain d6aqjb2: 6aqj B:183-327 [340207]
    Other proteins in same PDB: d6aqja1, d6aqjb1
    automated match to d4kqxb2
    complexed with 40e, edo, gol, hio, mg, ndp

Details for d6aqjb2

PDB Entry: 6aqj (more details), 1.37 Å

PDB Description: crystal structures of staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity.
PDB Compounds: (B:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6aqjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aqjb2 a.100.1.0 (B:183-327) automated matches {Staphylococcus aureus [TaxId: 273036]}
fkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyegg
menvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkefy
klreeqhghqiekvgrelremmpfi

SCOPe Domain Coordinates for d6aqjb2:

Click to download the PDB-style file with coordinates for d6aqjb2.
(The format of our PDB-style files is described here.)

Timeline for d6aqjb2:

  • d6aqjb2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from same chain:
(mouse over for more information)
d6aqjb1