Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Staphylococcus aureus [TaxId:273036] [340197] (4 PDB entries) |
Domain d6aqja2: 6aqj A:183-327 [340198] Other proteins in same PDB: d6aqja1, d6aqjb1 automated match to d4kqxb2 complexed with 40e, edo, gol, hio, mg, ndp |
PDB Entry: 6aqj (more details), 1.37 Å
SCOPe Domain Sequences for d6aqja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aqja2 a.100.1.0 (A:183-327) automated matches {Staphylococcus aureus [TaxId: 273036]} fkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyegg menvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkefy klreeqhghqiekvgrelremmpfi
Timeline for d6aqja2: