SCOPe 2.08: Domain d6aqja2: 6aqj A:183-327

Lineage for d6aqja2 (6aqj A:183-327)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:273036] [340197] (4 PDB entries)

8. Domain d6aqja2: 6aqj A:183-327 [340198]
   Other proteins in same PDB: d6aqja1, d6aqjb1
   automated match to d4kqxb2
   complexed with 40e, edo, gol, hio, mg, ndp

Details for d6aqja2

PDB Entry: 6aqj, 1.37 Å

PDB Description: crystal structures of staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity.

PDB Compounds: (A:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6aqja2:

Sequence; same for both SEQRES and ATOM records:

>d6aqja2 a.100.1.0 (A:183-327) automated matches {Staphylococcus aureus [TaxId: 273036]}
fkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyegg
menvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkefy
klreeqhghqiekvgrelremmpfi

Timeline for d6aqja2:

• d6aqja2 first appeared in SCOPe 2.06
  
• d6aqja2 appears in SCOPe 2.07