SCOPe 2.06: Domain d5vl3l2: 5vl3 L:107-209

Lineage for d5vl3l2 (5vl3 L:107-209)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
Domain d5vl3l2: 5vl3 L:107-209 [340163]
Other proteins in same PDB: d5vl3b1, d5vl3d1, d5vl3f1, d5vl3l1
automated match to d1dn0a2
complexed with bma, gol, man, nag

Details for d5vl3l2

PDB Entry: 5vl3 (more details), 3.1 Å

PDB Description: cd22 d1-d3 in complex with therapeutic fab epratuzumab

PDB Compounds: (L:) Epratuzumab Fab Light Chain

SCOPe Domain Sequences for d5vl3l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vl3l2 b.1.1.2 (L:107-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtks

SCOPe Domain Coordinates for d5vl3l2:

Click to download the PDB-style file with coordinates for d5vl3l2.
(The format of our PDB-style files is described here.)

Timeline for d5vl3l2: