SCOPe 2.06: Domain d5h4vf2: 5h4v F:299-466

Lineage for d5h4vf2 (5h4v F:299-466)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families)

5. Family a.97.1.0: automated matches [227179] (1 protein)
   not a true family

6. Protein automated matches [226898] (6 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:291331] [339993] (1 PDB entry)

8. Domain d5h4vf2: 5h4v F:299-466 [340149]
   Other proteins in same PDB: d5h4va1, d5h4vb1, d5h4vc1, d5h4vd1, d5h4ve1, d5h4vf1
   automated match to d4g6za2

Details for d5h4vf2

PDB Entry: 5h4v, 3 Å

PDB Description: structure of glutamyl-trna synthetase (xoo1504) from xanthomonas oryzae pv. oryzae

PDB Compounds: (F:) Glutamate--tRNA ligase

SCOPe Domain Sequences for d5h4vf2:

Sequence; same for both SEQRES and ATOM records:

>d5h4vf2 a.97.1.0 (F:299-466) automated matches {Xanthomonas oryzae [TaxId: 291331]}
dmaklgwvnqhylktddpasiapqleyqlaklgvdlaagpaaadvvvalrervhtlkema
ekavvwyqpletydaaavmkhlklgaevplgkarellaavdqwsvdsvsaalhdaaaale
lgmgkvaqplrvaitgtqvspdisqtvylagregalkridaaltkiga

Timeline for d5h4vf2:

• d5h4vf2 is new in SCOPe 2.06-stable
  
• d5h4vf2 appears in SCOPe 2.07
  
• d5h4vf2 appears in the current release, SCOPe 2.08