Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (50 species) not a true protein |
Species Xanthomonas oryzae [TaxId:291331] [339991] (1 PDB entry) |
Domain d5h4vf1: 5h4v F:2-298 [340148] Other proteins in same PDB: d5h4va2, d5h4vb2, d5h4vc2, d5h4vd2, d5h4ve2, d5h4vf2 automated match to d4g6za1 |
PDB Entry: 5h4v (more details), 3 Å
SCOPe Domain Sequences for d5h4vf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h4vf1 c.26.1.0 (F:2-298) automated matches {Xanthomonas oryzae [TaxId: 291331]} acrtrfapsptgylhiggartalycwlearrrggqfvlriedtdrqrstqaaidaileam qwlglgydegpiyqtqrvaryqevaeqllaqgkayyayetreeldamreaamakqekpry dgaareqnlpyrddpnrvirfknpiggtvvfddlikgrieianselddmvifrpdglpty nfavvvddwdmgitevirgddhinntprqiniyaalgapvpkfahmpmildeqgtklskr tgaadvmqykdagylphalinylarlgwshgdqelftpqelldlfdvkdvnskaarl
Timeline for d5h4vf1: