SCOPe 2.06: Domain d5h4vf1: 5h4v F:2-298

Lineage for d5h4vf1 (5h4v F:2-298)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (50 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:291331] [339991] (1 PDB entry)

8. Domain d5h4vf1: 5h4v F:2-298 [340148]
   Other proteins in same PDB: d5h4va2, d5h4vb2, d5h4vc2, d5h4vd2, d5h4ve2, d5h4vf2
   automated match to d4g6za1

Details for d5h4vf1

PDB Entry: 5h4v, 3 Å

PDB Description: structure of glutamyl-trna synthetase (xoo1504) from xanthomonas oryzae pv. oryzae

PDB Compounds: (F:) Glutamate--tRNA ligase

SCOPe Domain Sequences for d5h4vf1:

Sequence; same for both SEQRES and ATOM records:

>d5h4vf1 c.26.1.0 (F:2-298) automated matches {Xanthomonas oryzae [TaxId: 291331]}
acrtrfapsptgylhiggartalycwlearrrggqfvlriedtdrqrstqaaidaileam
qwlglgydegpiyqtqrvaryqevaeqllaqgkayyayetreeldamreaamakqekpry
dgaareqnlpyrddpnrvirfknpiggtvvfddlikgrieianselddmvifrpdglpty
nfavvvddwdmgitevirgddhinntprqiniyaalgapvpkfahmpmildeqgtklskr
tgaadvmqykdagylphalinylarlgwshgdqelftpqelldlfdvkdvnskaarl

Timeline for d5h4vf1:

• d5h4vf1 is new in SCOPe 2.06-stable
  
• d5h4vf1 appears in SCOPe 2.07
  
• d5h4vf1 appears in the current release, SCOPe 2.08