Lineage for d2bifb2 (2bif B:250-468)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498790Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2498791Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2499020Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)
  6. 2499021Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (2 species)
    bifunctional enzyme
  7. 2499025Species Norway rat (Rattus norvegicus) [TaxId:10116] [53269] (8 PDB entries)
  8. 2499033Domain d2bifb2: 2bif B:250-468 [34010]
    Other proteins in same PDB: d2bifa1, d2bifb1
    complexed with anp, bog, f6p, mg, po4, sin; mutant

Details for d2bifb2

PDB Entry: 2bif (more details), 2.4 Å

PDB Description: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase h256a mutant with f6p in phosphatase active site
PDB Compounds: (B:) protein (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase)

SCOPe Domain Sequences for d2bifb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bifb2 c.60.1.4 (B:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
siylcrageselnlkgriggdpglsprgrefskhlaqfisdqnikdlkvftsqmkrtiqt
aealsvpyeqfkvlneidagvceemtyeeiqdhyplefalrdqdkyryrypkgesyedlv
qrlepvimelerqenvlvichqavmrcllayfldkaaeelpylkcplhtvlkltpvaygc
kvesiflnvaavnthrdrpqnvdisrpseealvtvpahq

SCOPe Domain Coordinates for d2bifb2:

Click to download the PDB-style file with coordinates for d2bifb2.
(The format of our PDB-style files is described here.)

Timeline for d2bifb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bifb1