SCOPe 2.07: Domain d3bifa2: 3bif A:250-468

Lineage for d3bifa2 (3bif A:250-468)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)

6. Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (2 species)
   bifunctional enzyme

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53269] (8 PDB entries)

8. Domain d3bifa2: 3bif A:250-468 [34008]
   Other proteins in same PDB: d3bifa1
   complexed with bog, po4, sin

Details for d3bifa2

PDB Entry: 3bif, 2.3 Å

PDB Description: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase empty 6-pf-2k active site

PDB Compounds: (A:) protein (6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase)

SCOPe Domain Sequences for d3bifa2:

Sequence; same for both SEQRES and ATOM records:

>d3bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
siylcrhgeselnlkgriggdpglsprgrefskhlaqfisdqnikdlkvftsqmkrtiqt
aealsvpyeqfkvlneidagvceemtyeeiqdhyplefalrdqdkyryrypkgesyedlv
qrlepvimelerqenvlvichqavmrcllayfldkaaeelpylkcplhtvlkltpvaygc
kvesiflnvaavnthrdrpqnvdisrpseealvtvpahq

Timeline for d3bifa2:

• d3bifa2 first appeared (with stable ids) in SCOP 1.55
  
• d3bifa2 appears in SCOPe 2.06
  
• d3bifa2 appears in the current release, SCOPe 2.08