Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (38 species) not a true protein |
Species Hypocrea jecorina [TaxId:431241] [340063] (6 PDB entries) |
Domain d5tirb2: 5tir B:91-208 [340064] Other proteins in same PDB: d5tira1, d5tirb1, d5tirc1, d5tird1 automated match to d1bsma2 complexed with mn; mutant |
PDB Entry: 5tir (more details), 1.62 Å
SCOPe Domain Sequences for d5tirb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tirb2 d.44.1.0 (B:91-208) automated matches {Hypocrea jecorina [TaxId: 431241]} pdadpasapeltaeiaktwgsldkfkeamgkallgiqgsgwgwlvkegsglrivttkdqd pvvggevpvfgidmwehayylqylngkaayvdniwkvinwktaeqrfkgdredafkil
Timeline for d5tirb2: