Lineage for d5tirb2 (5tir B:91-208)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946391Species Hypocrea jecorina [TaxId:431241] [340063] (6 PDB entries)
  8. 2946393Domain d5tirb2: 5tir B:91-208 [340064]
    Other proteins in same PDB: d5tira1, d5tirb1, d5tirc1, d5tird1
    automated match to d1bsma2
    complexed with mn; mutant

Details for d5tirb2

PDB Entry: 5tir (more details), 1.62 Å

PDB Description: crystal structure of mn superoxide dismutase mutant m27v from trichoderma reesei
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d5tirb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tirb2 d.44.1.0 (B:91-208) automated matches {Hypocrea jecorina [TaxId: 431241]}
pdadpasapeltaeiaktwgsldkfkeamgkallgiqgsgwgwlvkegsglrivttkdqd
pvvggevpvfgidmwehayylqylngkaayvdniwkvinwktaeqrfkgdredafkil

SCOPe Domain Coordinates for d5tirb2:

Click to download the PDB-style file with coordinates for d5tirb2.
(The format of our PDB-style files is described here.)

Timeline for d5tirb2: