Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [53175] (17 PDB entries) Uniprot Q13126 |
Domain d5tc6a_: 5tc6 A: [340054] automated match to d1cb0a_ complexed with 7a6, cl, gol, na, po4 |
PDB Entry: 5tc6 (more details), 1.48 Å
SCOPe Domain Sequences for d5tc6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tc6a_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtim pskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgs hscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrt wgadvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktlkenankak slllttipqigstewsetlhnlknmaqfsvllp
Timeline for d5tc6a_: