Lineage for d5tc6a_ (5tc6 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2887829Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)
  7. 2887830Species Human (Homo sapiens) [TaxId:9606] [53175] (17 PDB entries)
    Uniprot Q13126
  8. 2887833Domain d5tc6a_: 5tc6 A: [340054]
    automated match to d1cb0a_
    complexed with 7a6, cl, gol, na, po4

Details for d5tc6a_

PDB Entry: 5tc6 (more details), 1.48 Å

PDB Description: crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with propylthio-immucillin-a
PDB Compounds: (A:) S-methyl-5'-thioadenosine phosphorylase

SCOPe Domain Sequences for d5tc6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tc6a_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtim
pskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgs
hscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrt
wgadvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktlkenankak
slllttipqigstewsetlhnlknmaqfsvllp

SCOPe Domain Coordinates for d5tc6a_:

Click to download the PDB-style file with coordinates for d5tc6a_.
(The format of our PDB-style files is described here.)

Timeline for d5tc6a_: