SCOPe 2.06: Domain d5ovob_: 5ovo B:

Lineage for d5ovob_ (5ovo B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (6 species)
   not a true protein

7. Species Azospirillum brasilense [TaxId:192] [189362] (11 PDB entries)

8. Domain d5ovob_: 5ovo B: [340047]
   Other proteins in same PDB: d5ovoa_
   automated match to d3mhya_
   complexed with adp, mg, mn

Details for d5ovob_

PDB Entry: 5ovo, 1.55 Å

PDB Description: structure of drag-glnz-delta42-54 complex from azospirillum brasilense

PDB Compounds: (B:) Nitrogen regulatory protein P-II 1

SCOPe Domain Sequences for d5ovob_:

Sequence; same for both SEQRES and ATOM records:

>d5ovob_ d.58.5.1 (B:) automated matches {Azospirillum brasilense [TaxId: 192]}
mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgflpkvkvevavsddqyeqv
veaiqkaantgrigdgkifvldiaqavrirtgetnteal

Timeline for d5ovob_:

• d5ovob_ is new in SCOPe 2.06-stable
  
• d5ovob_ appears in SCOPe 2.07
  
• d5ovob_ appears in the current release, SCOPe 2.08