SCOPe 2.08: Domain d5nr9b_: 5nr9 B:

Lineage for d5nr9b_ (5nr9 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
   automatically mapped to Pfam PF03414

6. Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64133] (28 PDB entries)
   Uniprot P14769

8. Domain d5nr9b_: 5nr9 B: [340044]
   automated match to d2vs4a_
   complexed with gol

Details for d5nr9b_

PDB Entry: 5nr9, 1.7 Å

PDB Description: a native ternary complex of alpha-1,3-galactosyltransferase (alpha- 3galt) supports a conserved reaction mechanism for retaining glycosyltransferases - unliganded alpha-3galt

PDB Compounds: (B:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOPe Domain Sequences for d5nr9b_:

Sequence; same for both SEQRES and ATOM records:

>d5nr9b_ c.68.1.9 (B:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
sklklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryi
ehyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdism
mrmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndfty
errkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshl
nkyfllnkptkilspeycwdyhiglpadiklvkmswqtke

Timeline for d5nr9b_:

• d5nr9b_ first appeared in SCOPe 2.06
  
• d5nr9b_ appears in SCOPe 2.07