Lineage for d5ov4a2 (5ov4 A:219-309)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190524Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2190724Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families) (S)
    automatically mapped to Pfam PF03900
  5. 2190733Family d.50.2.0: automated matches [227289] (1 protein)
    not a true family
  6. 2190734Protein automated matches [227108] (3 species)
    not a true protein
  7. 2190735Species Bacillus megaterium [TaxId:1404] [238215] (5 PDB entries)
  8. 2190740Domain d5ov4a2: 5ov4 A:219-309 [340041]
    Other proteins in same PDB: d5ov4a1, d5ov4a3
    automated match to d4mlva2
    mutant

Details for d5ov4a2

PDB Entry: 5ov4 (more details), 2.69 Å

PDB Description: bacillus megaterium porphobilinogen deaminase d82a mutant
PDB Compounds: (A:) porphobilinogen deaminase

SCOPe Domain Sequences for d5ov4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ov4a2 d.50.2.0 (A:219-309) automated matches {Bacillus megaterium [TaxId: 1404]}
nhdetaravraervflkemeggcqvpiagygrildggnieltslvaspdgktiykehitg
kdpiaigseaaerltsqgakllidrvkeeld

SCOPe Domain Coordinates for d5ov4a2:

Click to download the PDB-style file with coordinates for d5ov4a2.
(The format of our PDB-style files is described here.)

Timeline for d5ov4a2: