SCOP 1.71: Domain d1dkoa_: 1dko A:

Lineage for d1dkoa_ (1dko A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families)

5. Family c.60.1.2: Histidine acid phosphatase [53258] (3 proteins)

6. Protein Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53263] (4 species)

7. Species Escherichia coli [TaxId:562] [53266] (6 PDB entries)

8. Domain d1dkoa_: 1dko A: [34001]
   complexed with hg, wo4; mutant

Details for d1dkoa_

PDB Entry: 1dko, 2.38 Å

PDB Description: crystal structure of tungstate complex of escherichia coli phytase at ph 6.6 with tungstate bound at the active site and with hg2+ cation acting as an intermolecular bridge

SCOP Domain Sequences for d1dkoa_:

Sequence; same for both SEQRES and ATOM records:

>d1dkoa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli}
qsepelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylgh
yqrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqtdtss
pdplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclk
rekqdescsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritds
hqwntllslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfi
aghdtnlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqm
rdktplslntppgevkltlagceernaqgmcslagftqivnearipacsl

Timeline for d1dkoa_:

• d1dkoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1dkoa_ appears in SCOP 1.69
  
• d1dkoa_ appears in SCOP 1.73
  
• d1dkoa_ appears in the current release, SCOPe 2.08