Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d5w1wk2: 5w1w K:182-276 [339950] Other proteins in same PDB: d5w1wa1, d5w1wb1, d5w1wb2, d5w1wd2, d5w1wf1, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi2, d5w1wk1, d5w1wl1, d5w1wl2, d5w1wn2, d5w1wp1, d5w1wq1, d5w1wq2, d5w1ws2 automated match to d1efxa1 |
PDB Entry: 5w1w (more details), 3.1 Å
SCOPe Domain Sequences for d5w1wk2:
Sequence, based on SEQRES records: (download)
>d5w1wk2 b.1.1.0 (K:182-276) automated matches {Human (Homo sapiens) [TaxId: 9606]} leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf qkwaavvvpsgeeqrytchvqheglpepvtlrwkp
>d5w1wk2 b.1.1.0 (K:182-276) automated matches {Human (Homo sapiens) [TaxId: 9606]} leppkthvthhpisdheatlrcwalgfypaeitltwqqghtqdtelvetrpagdgtfqkw aavvvpsgeeqrytchvqheglpepvtlrwkp
Timeline for d5w1wk2:
View in 3D Domains from other chains: (mouse over for more information) d5w1wa1, d5w1wa2, d5w1wb1, d5w1wb2, d5w1wd1, d5w1wd2, d5w1we1, d5w1we2, d5w1wf1, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi1, d5w1wi2, d5w1wj1, d5w1wj2, d5w1wl1, d5w1wl2, d5w1wn1, d5w1wn2, d5w1wo1, d5w1wo2, d5w1wp1, d5w1wp2, d5w1wq1, d5w1wq2, d5w1ws1, d5w1ws2, d5w1wt1, d5w1wt2 |