Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [339888] (1 PDB entry) |
Domain d5x18a_: 5x18 A: [339948] automated match to d5fqdf_ complexed with gol, mla |
PDB Entry: 5x18 (more details), 1.8 Å
SCOPe Domain Sequences for d5x18a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x18a_ d.144.1.7 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} stivglhykigkkigegsfgvlfegtnmingvpvaikfeprkteapqlrdeyktykilng tpnipyayyfgqeglhnilvidllgpsledlfdwcgrkfsvktvvqvavqmitliedlha hdliyrdikpdnfligrpgqpdannihlidfgmakqyrdpktkqhipyrekkslsgtary msinthlgreqsrrddmealghvffyflrghlpwqglkapnnkqkyekigekkrstnvyd laqglpvqfgryleivrslsfeecpdyegyrklllsvlddlgetadgqydwmkl
Timeline for d5x18a_: