SCOPe 2.08: Domain d5x18a_: 5x18 A:

Lineage for d5x18a_ (5x18 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [339888] (1 PDB entry)

8. Domain d5x18a_: 5x18 A: [339948]
   automated match to d5fqdf_
   complexed with gol, mla

Details for d5x18a_

PDB Entry: 5x18, 1.8 Å

PDB Description: crystal structure of casein kinase i homolog 1

PDB Compounds: (A:) Casein kinase I homolog 1

SCOPe Domain Sequences for d5x18a_:

Sequence; same for both SEQRES and ATOM records:

>d5x18a_ d.144.1.7 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
stivglhykigkkigegsfgvlfegtnmingvpvaikfeprkteapqlrdeyktykilng
tpnipyayyfgqeglhnilvidllgpsledlfdwcgrkfsvktvvqvavqmitliedlha
hdliyrdikpdnfligrpgqpdannihlidfgmakqyrdpktkqhipyrekkslsgtary
msinthlgreqsrrddmealghvffyflrghlpwqglkapnnkqkyekigekkrstnvyd
laqglpvqfgryleivrslsfeecpdyegyrklllsvlddlgetadgqydwmkl

Timeline for d5x18a_:

• d5x18a_ first appeared in SCOPe 2.06
  
• d5x18a_ appears in SCOPe 2.07