Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (30 PDB entries) |
Domain d5wqpb1: 5wqp B:1-229 [339946] Other proteins in same PDB: d5wqpa2, d5wqpb2 automated match to d3wxbb_ complexed with na, nap, nca, po4 |
PDB Entry: 5wqp (more details), 1.7 Å
SCOPe Domain Sequences for d5wqpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wqpb1 c.2.1.0 (B:1-229) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh pgwvrtemggdsaplsveesaaglvaavedaagvnacrfvdyrnqplpw
Timeline for d5wqpb1: