SCOPe 2.08: Domain d5wqpb1: 5wqp B:1-229

Lineage for d5wqpb1 (5wqp B:1-229)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (30 PDB entries)

8. Domain d5wqpb1: 5wqp B:1-229 [339946]
   Other proteins in same PDB: d5wqpa2, d5wqpb2
   automated match to d3wxbb_
   complexed with na, nap, nca, po4

Details for d5wqpb1

PDB Entry: 5wqp, 1.7 Å

PDB Description: crystal structure of a carbonyl reductase from pseudomonas aeruginosa pao1 in complex with nadp (condition ii)

PDB Compounds: (B:) Probable dehydrogenase

SCOPe Domain Sequences for d5wqpb1:

Sequence; same for both SEQRES and ATOM records:

>d5wqpb1 c.2.1.0 (B:1-229) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
pgwvrtemggdsaplsveesaaglvaavedaagvnacrfvdyrnqplpw

Timeline for d5wqpb1:

• d5wqpb1 first appeared in SCOPe 2.06
  
• d5wqpb1 appears in SCOPe 2.07