SCOPe 2.08: Domain d5xcea_: 5xce A:

Lineage for d5xcea_ (5xce A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.0: automated matches [191347] (1 protein)
   not a true family

6. Protein automated matches [190255] (6 species)
   not a true protein

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [339925] (4 PDB entries)

8. Domain d5xcea_: 5xce A: [339926]
   automated match to d1z2wa1

Details for d5xcea_

PDB Entry: 5xce, 1.86 Å

PDB Description: crystal structure of wild type vps29 from entamoeba histolytica

PDB Compounds: (A:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d5xcea_:

Sequence; same for both SEQRES and ATOM records:

>d5xcea_ d.159.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mlvlvigdfhvphrsaaipqvfldrlntgriqtvlctgnlcgketydilrtlarevhvvk
gdfdemqglnetevikignfkiglmhghqvipwgdrealaiyqrqldvdilitghthkle
tkevggkyflnpgsatgaysplvdnpvpsfmlleindseltiyeytlvdgsvkcervdfn

Timeline for d5xcea_:

• d5xcea_ first appeared in SCOPe 2.06
  
• d5xcea_ appears in SCOPe 2.07