Lineage for d1cvid_ (1cvi D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2891136Family c.60.1.2: Histidine acid phosphatase [53258] (4 proteins)
  6. 2891168Protein Prostatic acid phosphatase [53259] (2 species)
  7. 2891169Species Human (Homo sapiens) [TaxId:9606] [53261] (4 PDB entries)
  8. 2891185Domain d1cvid_: 1cvi D: [33992]
    complexed with gly, nag

Details for d1cvid_

PDB Entry: 1cvi (more details), 3.2 Å

PDB Description: crystal structure of human prostatic acid phosphatase
PDB Compounds: (D:) prostatic acid phosphatase

SCOPe Domain Sequences for d1cvid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvid_ c.60.1.2 (D:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]}
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt

SCOPe Domain Coordinates for d1cvid_:

Click to download the PDB-style file with coordinates for d1cvid_.
(The format of our PDB-style files is described here.)

Timeline for d1cvid_: