SCOPe 2.06: Domain d5w1wd2: 5w1w D:130-218

Lineage for d5w1wd2 (5w1w D:130-218)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5w1wd2: 5w1w D:130-218 [339912]
   Other proteins in same PDB: d5w1wa1, d5w1wa2, d5w1wb1, d5w1wb2, d5w1wd1, d5w1we1, d5w1we2, d5w1wf1, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi1, d5w1wj1, d5w1wj2, d5w1wk1, d5w1wk2, d5w1wl1, d5w1wl2, d5w1wn1, d5w1wo1, d5w1wo2, d5w1wp1, d5w1wp2, d5w1wq1, d5w1wq2, d5w1ws1, d5w1wt1, d5w1wt2
   automated match to d2f54d2

Details for d5w1wd2

PDB Entry: 5w1w, 3.1 Å

PDB Description: structure of the hla-e-vmaprtlvl/gf4 tcr complex

PDB Compounds: (D:) GF4 T cell receptor alpha chain

SCOPe Domain Sequences for d5w1wd2:

Sequence; same for both SEQRES and ATOM records:

>d5w1wd2 b.1.1.2 (D:130-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d5w1wd2:

• d5w1wd2 is new in SCOPe 2.06-stable
  
• d5w1wd2 appears in SCOPe 2.07
  
• d5w1wd2 appears in the current release, SCOPe 2.08