SCOPe 2.06: Domain d5wqnd_: 5wqn D:

Lineage for d5wqnd_ (5wqn D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (27 PDB entries)

8. Domain d5wqnd_: 5wqn D: [339909]
   automated match to d3wxbb_

Details for d5wqnd_

PDB Entry: 5wqn, 2 Å

PDB Description: crystal structure of a carbonyl reductase from pseudomonas aeruginosa pao1 (condition ii)

PDB Compounds: (D:) Probable dehydrogenase

SCOPe Domain Sequences for d5wqnd_:

Sequence, based on SEQRES records:

>d5wqnd_ c.2.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
pgwvrtemggdsaplsveesaaglvaavedaagvnacrfvdyrnqplpw

Sequence, based on observed residues (ATOM records):

>d5wqnd_ c.2.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
pgwvrtemsaplsveesaaglvaavedaagvnacrfvdyrnqplpw

Timeline for d5wqnd_:

• d5wqnd_ is new in SCOPe 2.06-stable
  
• d5wqnd_ appears in SCOPe 2.07
  
• d5wqnd_ appears in the current release, SCOPe 2.08