SCOPe 2.08: Domain d5x72a_: 5x72 A:

Lineage for d5x72a_ (5x72 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein GMP-PDE delta [74846] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74847] (25 PDB entries)

8. Domain d5x72a_: 5x72 A: [339904]
   automated match to d4jv8b_
   complexed with p59, p69

Details for d5x72a_

PDB Entry: 5x72, 1.95 Å

PDB Description: the crystal structure pde delta in complex with (rac)-p9

PDB Compounds: (A:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d5x72a_:

Sequence, based on SEQRES records:

>d5x72a_ b.1.18.8 (A:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
msakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavs
relnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpa
svltgnviietkffdddllvstsrvrlfyv

Sequence, based on observed residues (ATOM records):

>d5x72a_ b.1.18.8 (A:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
msakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavs
relnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapsqmmpas
vltgnviietkffdddllvstsrvrlfyv

Timeline for d5x72a_:

• d5x72a_ first appeared in SCOPe 2.06
  
• d5x72a_ appears in SCOPe 2.07