Lineage for d1cvib_ (1cvi B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489762Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 489763Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 489803Family c.60.1.2: Histidine acid phosphatase [53258] (3 proteins)
  6. 489827Protein Prostatic acid phosphatase [53259] (2 species)
  7. 489828Species Human (Homo sapiens) [TaxId:9606] [53261] (4 PDB entries)
  8. 489838Domain d1cvib_: 1cvi B: [33990]

Details for d1cvib_

PDB Entry: 1cvi (more details), 3.2 Å

PDB Description: crystal structure of human prostatic acid phosphatase

SCOP Domain Sequences for d1cvib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvib_ c.60.1.2 (B:) Prostatic acid phosphatase {Human (Homo sapiens)}
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt

SCOP Domain Coordinates for d1cvib_:

Click to download the PDB-style file with coordinates for d1cvib_.
(The format of our PDB-style files is described here.)

Timeline for d1cvib_: