Lineage for d5vt9b1 (5vt9 B:73-210)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1997730Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1997731Protein automated matches [190513] (30 species)
    not a true protein
  7. 1997932Species Toxoplasma gondii [TaxId:5811] [339885] (1 PDB entry)
  8. 1997934Domain d5vt9b1: 5vt9 B:73-210 [339886]
    Other proteins in same PDB: d5vt9b2
    automated match to d4aqrb_

Details for d5vt9b1

PDB Entry: 5vt9 (more details), 1.85 Å

PDB Description: myosin light chain 1 and myoa complex
PDB Compounds: (B:) Myosin light chain TgMLC1

SCOPe Domain Sequences for d5vt9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vt9b1 a.39.1.0 (B:73-210) automated matches {Toxoplasma gondii [TaxId: 5811]}
aleemveademyarfnarasggkvstgdamilarqlglapsyadkqafeeksgdnldyas
fqkfvgtsthpedniedlveafayfdvskhgyltrkqmgnilmtygepltteefnalaae
yftsdqidyrqfckamle

SCOPe Domain Coordinates for d5vt9b1:

Click to download the PDB-style file with coordinates for d5vt9b1.
(The format of our PDB-style files is described here.)

Timeline for d5vt9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vt9b2
View in 3D
Domains from other chains:
(mouse over for more information)
d5vt9a_