Lineage for d5wqna_ (5wqn A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108430Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (27 PDB entries)
  8. 2108473Domain d5wqna_: 5wqn A: [339878]
    automated match to d3wxbb_

Details for d5wqna_

PDB Entry: 5wqn (more details), 2 Å

PDB Description: crystal structure of a carbonyl reductase from pseudomonas aeruginosa pao1 (condition ii)
PDB Compounds: (A:) Probable dehydrogenase

SCOPe Domain Sequences for d5wqna_:

Sequence, based on SEQRES records: (download)

>d5wqna_ c.2.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
pgwvrtemggdsaplsveesaaglvaavedaagvnacrfvdyrnqplpw

Sequence, based on observed residues (ATOM records): (download)

>d5wqna_ c.2.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
pglsveesaaglvaavedaagvnacrfvdyrnqplpw

SCOPe Domain Coordinates for d5wqna_:

Click to download the PDB-style file with coordinates for d5wqna_.
(The format of our PDB-style files is described here.)

Timeline for d5wqna_: